reversed-phase HPLC raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-07-28 and is reviewed periodically as new material appears.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
Reconstitution practices affect downstream measurements. The dry powder is typically dissolved in sterile water or a suitable aqueous buffer, then mixed gently rather than vortexed at high speed. Visible particles or cloudiness suggest incomplete dissolution or contamination and should be investigated. For long-term storage, aliquots should be labeled with concentration, solvent, and date. Open questions include how different buffers alter peptide conformation and whether specific container materials adsorb the peptide. Those variables can change apparent concentration in assays even when the chemical identity is correct.
Lyophilized TB-500 is hygroscopic and should be kept dry before use. The usual storage recommendation for the solid is -20 °C, protected from light and moisture. Once dissolved, the peptide is less stable, and repeated freeze-thaw cycles can promote aggregation or degradation. Laboratories often divide a reconstituted solution into single-use aliquots and store them at -80 °C. Exact stability limits depend on buffer, pH, and concentration, so published data do not define a single universal condition.
Identity and purity are checked with chromatographic and mass spectrometric methods. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities, while mass spectrometry confirms the expected molecular mass. A certificate of analysis may report a purity percentage, but the laboratory should still verify the material independently. Common quality concerns include truncated sequences, deamidation, oxidation, and residual solvents from synthesis. Because TB-500 is short, some impurities can differ from the target by only a few mass units.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Thymosin beta-4 fragment; TB4 fragment | Naming is inconsistent across suppliers and publications |
| Reported sequence | Ac-LKKTETQ | Corresponds to residues 17-23 of the parent protein |
| Frequently cited registry number | 77591-33-4 | Associated with full-length thymosin beta-4 rather than the fragment |
| Common supplied form | Freeze-dried solid | Often presented as an acetate or trifluoroacetate salt |
| Regulatory treatment | Varies by country | Frequently handled as a research chemical; not broadly approved as a therapeutic |
Identity and purity checks for peptide material typically combine reversed-phase high-performance liquid chromatography with mass measurement, since retention time alone cannot confirm a sequence. Mass measurement verifies the expected molecular mass within instrument tolerance, while chromatographic peak area provides a purity estimate. Anti-doping analysis of urine uses related but more sensitive workflows, sometimes after solid-phase extraction. For research material, batch documentation, certificate content, and independent testing are common points of scrutiny, because supply chains outside pharmaceutical regulation vary widely in the paperwork they provide.
Reconstitution of a lyophilized peptide is normally done with sterile water or a suitable buffer under aseptic conditions. Adding solvent down the vial wall and allowing gentle dissolution instead of vigorous vortexing reduces the chance of aggregation, which can lower the effective concentration of the resulting solution. Concentrated stocks are usually diluted into working buffer shortly before use. Because no standard preparation protocol exists for TB-500 specifically, laboratories adapt general peptide handling practice, and reported results may reflect differing preparation choices.
Dry peptide powder is commonly kept at −20 °C in a desiccated container away from light, a practice that limits moisture uptake and oxidation. Once dissolved, solutions are generally held at 2–8 °C for short periods or frozen at −20 °C or lower for longer storage, with repeated freeze-thaw cycles avoided. Hydrolysis and oxidation are the main degradation routes for peptides in solution, and both accelerate at higher temperature or extreme pH. Published stability data specific to TB-500 are limited, so shelf life should be treated as uncertain.
Interest in the peptide grew during the 2000s and 2010s, when studies of tendon and ligament injuries in horses reported changes in lesion size after treatment. Those reports circulated widely outside the scientific literature and shaped much of the current online discussion. Subsequent reviews noted inconsistent study design, small groups, and a shortage of independent replication. Popular descriptions often blur the line between the fragment, the complete protein, and unrelated growth factors, which complicates comparisons across sources.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Material sold under this label typically arrives as a freeze-dried powder in a sealed vial with a certificate of analysis. Such certificates usually report reversed-phase chromatography purity plus a mass confirmation, and stated purities commonly sit between 95 and 99 percent. Counter-ion identity, residual trifluoroacetate, water content, and peptide net weight are separate specifications that a certificate may or may not include. A purity figure alone does not establish sequence identity, so independent mass verification remains the practical check.
The designation TB-500 circulates in laboratory and catalog contexts without a single agreed definition. Most product listings apply it to an N-terminally acetylated seven-residue fragment of thymosin beta-4, while other listings attach the same label to the full 43-residue protein. Because the term is commercial rather than systematic, two entries bearing identical names may describe different molecules. Any documentation should therefore state which sequence a given sample is claimed to contain.
The fragment most often associated with the name carries the sequence Ac-LKKTETQ, matching residues 17 through 23 of thymosin beta-4. That region holds the actin-binding motif responsible for much of the parent protein's biochemical activity. Apart from N-terminal acetylation the peptide is unmodified and contains no disulfide bonds, so it shows little ordered secondary structure in solution. Full-length thymosin beta-4 is instead a 43-residue polypeptide of roughly 4.9 kDa found widely across mammalian cell types.
Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.
Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
== Snacks == Roasted groundnut (peanuts)—served in a spill of paper Samusa (samousa, sumbusa, samosa)—Indian samosas are highly assimilated into the local cuisine, as are chapati and curry Mugaati n'amaggi (bread and eggs)—Originally an Arab dish, it consists of wheat dough spread into a thin pancake, filled with minced meat and raw egg, and then folded into a neat parcel, which is fried on a skillet or hotplate. Nsenene—a seasonal delicacy of a type of locust Nswaa—served similarly to nsenene, but made of white ants Rolex—a chapati filled with eggs, onions, cabbage or kale, and tomatoes; minced meat is sometimes added
Eucalyptus globulus, commonly known as southern blue gum, is a species of flowering plant in the family Myrtaceae. It is a tall, evergreen tree endemic to southeastern Australia. This Eucalyptus species has mostly smooth bark, juvenile leaves that are whitish and waxy on the lower surface, glossy green, lance-shaped adult leaves, glaucous, ribbed flower buds arranged singly or in groups of three or seven in leaf axils, white flowers and woody fruit. There are four subspecies, each with a different distribution across Australia, occurring in New South Wales, Victoria and Tasmania. The subspecies are the Victorian blue gum, Tasmanian blue gum, Maiden's gum, and Victorian eurabbie.
Alzheimer's disease: A study published in Archives of Neurology in February 2003 suggested that the intake of both trans fats and saturated fats promote the development of Alzheimer disease, although not confirmed in an animal model. It has been found that trans fats impaired memory and learning in middle-age rats. The trans-fat eating rats' brains had fewer proteins critical to healthy neurological function and inflammation in and around the hippocampus, the part of the brain responsible for learning and memory. These are the exact types of changes normally seen at the onset of Alzheimer's, but seen after six weeks, even though the rats were still young. A systematic review of five articles based on four prospective cohort studies of individuals did not find a robust association between their intake of trans fatty acids and development of Alzheimer's disease (or several other forms of dementia). The review based this conclusion on finding that 4 of the 5 reports appeared biased and therefore recommended more well-designed prospective studies to clarify this issue. Cancer: In 2007 the American Cancer Society stated that a relationship between trans fats and cancer "has not been determined." One study has found a positive connection between trans fat and prostate cancer. However, a larger study found a correlation between trans fats and a significant decrease in high-grade prostate cancer.
=== 16 September === The RSF carried out a drone attack that destroyed an ammunition dump within the garrison of the SAF's Fifth Division in El Obeid, resulting in an unspecified number of casualties.
Tumor growth (see HP59) Revascularization or neovascularization after trauma, for example, after cardiac ischemia or retinal ischemia Endometriosis - It appears that up to 37% of the microvascular endothelium of the ectopic endometrial tissue originates from endothelial progenitor cells.
Sources: en.wikipedia.org
=== Mechanical diagnostics === An advanced fleet management systems (FMS) can connect to the vehicle's onboard computer, and gather data for the user. Data such as mileage and fuel consumption are gathered into a global statistics scheme.
==== IV. Gene Delivery through Electrostatic Interactions ==== Microbubbles also serve a non-viral vector for gene transfection through electrostatic bonds between a positively charged microbubble outer shell and negatively charged nucleic acids. The transient pores formed by microbubble collapse allow the genetic material to pass into the target cells in a safer and more specific manner than current treatment methods. Microbubbles have been used to deliver microRNAs, plasmids, small interfering RNA, and messenger RNA.
Labiaplasty is a controversial subject. Critics argue that a woman's decision to undergo the procedure stems from an unhealthy self-image induced by their comparison of themselves to the prepubescent-like images of women they see in commercials or pornography. In Australia, the Royal Australian College of General Practitioners has issued guidelines on referring patients with dissatisfaction with their genitals to specialists. A change in requirements of publicly funded Australian plastic surgery requiring women to be told about natural variation in labias led to a 28% reduction in the numbers of surgeries performed. Unlike public hospitals, cosmetic surgeons in private practise are not required to follow these rules, and critics say that "unscrupulous" providers are charging to perform the procedure on women who would not undergo it if they had more information. Increasing numbers of women in Western countries are also using Brazilian waxing to remove pubic hair, and choosing to wear tight-fitting swimwear and clothing. This has led to increased numbers of women complaining of pain and discomfort from chafing of the labia minora, as well as cosmetic concerns around how the appearance of genitals. In many countries, media regulation classifies "hardcore" and "softcore" pornography – demanding that magazines with "hardcore" pornography be wrapped in black plastic and sold only to people over 18 who show photo ID. Sales of magazines in black plastic tend to be low, and thus many magazine publishers choose to comply with the "softcore" standards.
==== NAADP does activate TPCs ==== The surprising conclusion in 2012 that TPCs are not involved in NAADP signalling was due to two technical difficulties that have since been overcome or explained. (i) The transgenic mice (designed to knockout both TPC1 and TPC2; double-knockout, DKO) retained sensitivity to NAADP. However, others have questioned whether these mice are true DKO when they are predicted to retain >90% of the TPC protein sequences (i.e. they express only mildly truncated TPCs which are still functional and NAADP-sensitive ). In a different DKO mouse that is demonstrably TPC-null, NAADP responses are completely abolished, confirming TPCs are an NAADP target. (ii) The authors could not observe NAADP-stimulated currents in patched lysosomes. These technically challenging protocols were overcome by others who have successfully observed NAADP-dependent lysosomal currents that are dependent on TPCs.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
These two are the heaviest isotopes of dubnium to date, and both were produced as a result of decay of the heavier nuclei 288Mc and 294Ts rather than directly, because the experiments that yielded them were originally designed in Dubna for 48Ca beams. For its mass, 48Ca has by far the greatest neutron excess of all practically stable nuclei, both quantitative and relative, which correspondingly helps synthesize superheavy nuclei with more neutrons, but this gain is compensated by the decreased likelihood of fusion for high atomic numbers.
== Evolution == Serpins are the most widely distributed and largest superfamily of protease inhibitors. They were initially believed to be restricted to eukaryote organisms, but have since been found in bacteria, archaea and some viruses. It remains unclear whether prokaryote genes are the descendants of an ancestral prokaryotic serpin or the product of horizontal gene transfer from eukaryotes. Most intracellular serpins belong to a single phylogenetic clade, whether they come from plants or animals, indicating that the intracellular and extracellular serpins may have diverged before the plants and animals. Exceptions include the intracellular heat shock serpin HSP47, which is a chaperone essential for proper folding of collagen, and cycles between the cis-Golgi and the endoplasmic reticulum. Protease-inhibition is thought to be the ancestral function, with non-inhibitory members the results of evolutionary neofunctionalisation of the structure. The S to R conformational change has also been adapted by some binding serpins to regulate affinity for their targets.
Henry's law states that the mole fraction of a dissolved gas (xg) is equal to the partial pressure of the gas (pg) at equilibrium divided by Henry's law constant (H). Gas solubility coefficients are used to calculate Henry's law constant:
According to Japanese custom, ingredients are chosen to reflect the seasons and to provide contrasts of color, texture, and flavor. Thus negi and tofu, a strongly flavored ingredient mixed with a mildly flavored ingredient, are often combined. Ingredients that float, such as wakame seaweed, and ingredients that sink, such as potatoes, are also combined. Ingredients may include mushrooms (nameko or shiitake), potato, taro, seaweed, green laver, onion, nira, common bean, mitsuba, shrimp, fish, clams, and sliced daikon. Almost any Japanese ingredient may be added to some type of miso soup. However typical miso soup recipes contain a small number of additional ingredients beyond dashi stock and miso. If pork is added to miso soup it is called tonjiru, meaning 'pork soup'. Tonjiru is a soup served for dinner and lunch and not usually eaten for breakfast. Hearty and robust cold-weather variations may include daikon, deep-fried tofu (abura-age), potatoes, onions and dark miso. Lighter variations are better suited for spring and summer and made with ingredients such as cabbage, seri, myoga and/or eggplant.
== Incidence == Insulinomas are rare neuroendocrine tumours with an incidence estimated at one to four new cases per million persons per year. Insulinoma is one of the most common types of tumours arising from the islets of Langerhans cells (pancreatic endocrine tumours). Estimates of malignancy (metastases) range from 5 to 30%. Over 99% of insulinomas originate in the pancreas, with rare cases from ectopic pancreatic tissue. About 5% of cases are associated with tumours of the parathyroid glands and the pituitary (multiple endocrine neoplasia type 1) and are more likely to be multiple and malignant. Most insulinomas are small, less than 2 cm.
Sources: en.wikipedia.org
The leading proposal involves sequestration of monomeric actin, which would alter cytoskeletal turnover and cell movement. The actin-binding motif shared with the parent protein is central to that idea. Direct confirmation in whole organisms remains limited.
Very few controlled human studies focus on the seven-residue sequence itself. Most clinical data concern the full-length protein in cardiac or ophthalmic settings. Conclusions drawn for one form should not be assumed to transfer to the other.
Detection normally relies on reversed-phase liquid chromatography paired with mass spectrometry. Chromatographic retention time establishes the expected elution window, and the mass spectrum confirms the molecular ion. Immunoassays exist but can cross-react with related peptides.
The dry powder is normally kept at -20 °C, protected from light and moisture. Reconstituted solutions are often divided into aliquots and stored at -80 °C to reduce freeze-thaw damage.